PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005793
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 414aa    MW: 44949.6 Da    PI: 8.2778
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-49052PU_refplantGDBView CDS
gnl|UG|Lsa#S32125566PU_unrefUnigeneView CDS
gnl|UG|Lsa#S58678473PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.66.9e-26162205144
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr+rsrk++e
  Lsa005793 162 DPEPGRCRRTDGKKWRCSRDVVAGHKYCERHIHRGRNRSRKPVE 205
                79***************************************987 PP

2QLQ38.82.8e-1495126233
        QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33 
                +F+  Q+q+L+ Q+l+y+y++ + P+Pp+Ll 
  Lsa005793  95 YFSVGQWQELEVQALIYRYMLTGSPIPPQLLH 126
                68889*************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-694130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166615.59795130IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.4E-1096126IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.386162206IPR014977WRC domain
PfamPF088795.9E-22163205IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
XKNLLTHTYS KEAAEEAAIY LTVCLNLFLS STLNKYLICL PSPSMDFHLK QWAHQNQHQP  60
DDSSASLALP LFSSEPTSSS SSSKPSKMMQ GVSGYFSVGQ WQELEVQALI YRYMLTGSPI  120
PPQLLHLLLN STSNTNPPFY PLSNFPSLCQ TGGGYWGRGG MDPEPGRCRR TDGKKWRCSR  180
DVVAGHKYCE RHIHRGRNRS RKPVEIPTPT TSTATAGSRG GDVDYGVGLV KKPTSVYTTT  240
AAAAGYGGAQ TYTGSTNCGG SVSGHSPFFD QLHLNQRVDD KAAYRSSENE DKLSGGRILR  300
PFFNDWPRTV QEQETLATSL SISVTGNATS DFSLKLSTGN DETGPRGEEI NGERERASLS  360
WGMQWGTHHA GSLGGPLAEA LRSSSTSNTS SPTSVLHQLQ RGSTTTSETS YVST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277233.31e-107PREDICTED: growth-regulating factor 3
TrEMBLA0A103XFB61e-131A0A103XFB6_CYNCS; Glutamine-Leucine-Glutamine, QLQ
STRINGVIT_08s0007g03760.t011e-104(Vitis vinifera)